General Information

  • ID:  hor004615
  • Uniprot ID:  Q7XAD0(71-85)
  • Protein name:  HypSys III
  • Gene name:  NA
  • Organism:  Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
  • Family:  Systemin family
  • Source:  Plant
  • Expression:  By wounding and methyl jasmonate in leaves. |Leaves.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Solanum subgen. Lycopersicon (subgenus), Solanum (genus), Solaneae (tribe), Solanoideae (subfamily), Solanaceae (family), Solanales (order), lamiids, asterids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity
  • GO BP:  GO:0006952 defense response; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GRHDSVLPPPSPKTD
  • Length:  15(71-85)
  • Propeptide:  MISFFRAFFLIIIISFLIFVGAQARTLLGNYHDDEMLIELKLESGNYGRTPYKTPPPPTSSSPTHQEIVNGRHDSVLPPPSPKTDPIIGQLTTITTTPHHDDTVAAPPVGGRHDYVASPPPPKPQDEQRQIIITSSSSTLPLQASY
  • Signal peptide:  MISFFRAFFLIIIISFLIFVGAQA
  • Modification:  T9 4-hydroxyproline;T10 4-hydroxyproline;T12 4-hydroxyproline
  • Glycosylation:  T9 O-linked (Ara...) hydroxyproline;T10 O-linked (Ara...) hydroxyproline;T12 O-linked (Ara...) hydroxyproline
  • Mutagenesis:  NA

Activity

  • Function:  they are part of the wound signaling of tomato plants that activates defense against herbivores and pathogens
  • Mechanism:  Cause an alkalinization of suspension-cultured cells and induce the synthesis of defensive proteinase inhibitor proteins
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q7XAD0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004615_AF2.pdbhor004615_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 185265 Formula: C69H111N21O23
Absent amino acids: ACEFIMNQWY Common amino acids: P
pI: 7.55 Basic residues: 3
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -131.33 Boman Index: -4204
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 45.33
Instability Index: 11566.67 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA